PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.333QY
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 335aa    MW: 37655.2 Da    PI: 7.1125
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.333QYgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.11.2e-51141391128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrF Ptdeel+v+yL++kv+g++++l  +i+e+d+yk++Pw Lp k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g+
  Araip.333QY  14 LPPGFRFYPTDEELLVQYLCRKVAGNHFSL-PIIAEIDLYKFDPWILPGKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITT-EGR 109
                  79**************************99.88***************7767799*************************************99.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  +vg+kk Lvfy g+apkg+kt+W+mheyrl
  Araip.333QY 110 KVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                  ****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6510164IPR003441NAC domain
PROSITE profilePS5100560.08914163IPR003441NAC domain
PfamPF023651.8E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGVPEKDPLS QLSLPPGFRF YPTDEELLVQ YLCRKVAGNH FSLPIIAEID LYKFDPWILP  60
GKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVITTEGRK VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLL NGSQKSLGST KLDDWVLCRI YKKNLSSSQK VNMPSFTSKE  180
WSNGSSPSSS SHIDDMLELP EIDDRCFALP RVNSLQHEEK LTLGGTGNNF PDWVNSGGLD  240
SVPEFGSQSQ GMTSYDGNDL YVPSASQFCH VNTMVVPGNP TEEEVQSGIR TQRIDENFGL  300
FQQNSNVFTH RYLSSSGDSF GFGYPNQQFG FGFRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10311704171NO APICAL MERISTEM PROTEIN
1ut4_B1e-10311704171NO APICAL MERISTEM PROTEIN
1ut7_A1e-10311704171NO APICAL MERISTEM PROTEIN
1ut7_B1e-10311704171NO APICAL MERISTEM PROTEIN
3swm_A1e-10311707174NAC domain-containing protein 19
3swm_B1e-10311707174NAC domain-containing protein 19
3swm_C1e-10311707174NAC domain-containing protein 19
3swm_D1e-10311707174NAC domain-containing protein 19
3swp_A1e-10311707174NAC domain-containing protein 19
3swp_B1e-10311707174NAC domain-containing protein 19
3swp_C1e-10311707174NAC domain-containing protein 19
3swp_D1e-10311707174NAC domain-containing protein 19
4dul_A1e-10311704171NAC domain-containing protein 19
4dul_B1e-10311704171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7550220.0EU755022.1 Arachis hypogaea cultivar Yueyou 7 NAC-like transcription factor (NAC3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016188607.10.0PREDICTED: NAC domain-containing protein 72-like isoform X2
SwissprotQ93VY31e-119NAC72_ARATH; NAC domain-containing protein 72
TrEMBLC6EU670.0C6EU67_ARAHY; NAC-like transcription factor
STRINGGLYMA12G22880.11e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-117NAC family protein